Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of DEPDC1 monoclonal antibody (M05), clone 6H1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about DEPDC1 monoclonal antibody (M05), clone 6H1
| Brand: | Abnova |
| Reference: | H00055635-M05 |
| Product name: | DEPDC1 monoclonal antibody (M05), clone 6H1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DEPDC1. |
| Clone: | 6H1 |
| Isotype: | IgG2a Lambda |
| Gene id: | 55635 |
| Gene name: | DEPDC1 |
| Gene alias: | DEP.8|DEPDC1-V2|DEPDC1A|FLJ20354|SDP35 |
| Gene description: | DEP domain containing 1 |
| Genbank accession: | NM_017779 |
| Immunogen: | DEPDC1 (NP_060249, 93 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRNLSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV |
| Protein accession: | NP_060249 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged DEPDC1 is 0.1 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Inhibition of DEPDC1A, a Bad Prognostic Marker in Multiple Myeloma, Delays Growth and Induces Mature Plasma Cell Markers in Malignant Plasma Cells.Kassambara A, Schoenhals M, Moreaux J, Veyrune JL, Reme T, Goldschmidt H, Hose D, Klein B PLoS One. 2013 Apr 30;8(4):e62752. doi: 10.1371/journal.pone.0062752. Print 2013. |