H00055624-M07_100ug
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IHC-P,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00055624-M07 |
Product name: | POMGNT1 monoclonal antibody (M07), clone 6C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant POMGNT1. |
Clone: | 6C12 |
Isotype: | IgG2a Kappa |
Gene id: | 55624 |
Gene name: | POMGNT1 |
Gene alias: | DKFZp761B182|FLJ20277|GNTI.2|MEB|MGAT1.2 |
Gene description: | protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase |
Genbank accession: | NM_017739 |
Immunogen: | POMGNT1 (NP_060209, 221 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FGEKHSKSPALSSWGDPVLLKTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVLNVPVAVIAGNRPNYLYRM |
Protein accession: | NP_060209 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunoperoxidase of monoclonal antibody to POMGNT1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,ELISA,WB-Re |
Shipping condition: | Dry Ice |