POMGNT1 monoclonal antibody (M07), clone 6C12 View larger

POMGNT1 monoclonal antibody (M07), clone 6C12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of POMGNT1 monoclonal antibody (M07), clone 6C12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re

More info about POMGNT1 monoclonal antibody (M07), clone 6C12

Brand: Abnova
Reference: H00055624-M07
Product name: POMGNT1 monoclonal antibody (M07), clone 6C12
Product description: Mouse monoclonal antibody raised against a partial recombinant POMGNT1.
Clone: 6C12
Isotype: IgG2a Kappa
Gene id: 55624
Gene name: POMGNT1
Gene alias: DKFZp761B182|FLJ20277|GNTI.2|MEB|MGAT1.2
Gene description: protein O-linked mannose beta1,2-N-acetylglucosaminyltransferase
Genbank accession: NM_017739
Immunogen: POMGNT1 (NP_060209, 221 a.a. ~ 318 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: FGEKHSKSPALSSWGDPVLLKTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVLNVPVAVIAGNRPNYLYRM
Protein accession: NP_060209
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055624-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055624-M07-3-8-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to POMGNT1 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy POMGNT1 monoclonal antibody (M07), clone 6C12 now

Add to cart