Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FLJ20097 monoclonal antibody (M01A), clone 2D11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,WB-Ti,ELISA,WB-Re |
More info about FLJ20097 monoclonal antibody (M01A), clone 2D11
| Brand: | Abnova |
| Reference: | H00055610-M01A |
| Product name: | FLJ20097 monoclonal antibody (M01A), clone 2D11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant FLJ20097. |
| Clone: | 2D11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 55610 |
| Gene name: | CCDC132 |
| Gene alias: | FLJ20097|FLJ23581|KIAA1861|MGC176659 |
| Gene description: | coiled-coil domain containing 132 |
| Genbank accession: | NM_017667 |
| Immunogen: | FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR |
| Protein accession: | NP_060137 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | FLJ20097 monoclonal antibody (M01A), clone 2D11 Western Blot analysis of FLJ20097 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
| Shipping condition: | Dry Ice |