FLJ20097 monoclonal antibody (M01), clone 2D11 View larger

FLJ20097 monoclonal antibody (M01), clone 2D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ20097 monoclonal antibody (M01), clone 2D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,IHC-P,IF,ELISA,WB-Re

More info about FLJ20097 monoclonal antibody (M01), clone 2D11

Brand: Abnova
Reference: H00055610-M01
Product name: FLJ20097 monoclonal antibody (M01), clone 2D11
Product description: Mouse monoclonal antibody raised against a partial recombinant FLJ20097.
Clone: 2D11
Isotype: IgG2b Kappa
Gene id: 55610
Gene name: CCDC132
Gene alias: FLJ20097|FLJ23581|KIAA1861|MGC176659
Gene description: coiled-coil domain containing 132
Genbank accession: NM_017667
Immunogen: FLJ20097 (NP_060137, 862 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDKEFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDDIDRPKR
Protein accession: NP_060137
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055610-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00055610-M01-1-1-1.jpg
Application image note: FLJ20097 monoclonal antibody (M01), clone 2D11 Western Blot analysis of FLJ20097 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,WB-Ti,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: EARP is a multisubunit tethering complex involved in endocytic recycling.Schindler C, Chen Y, Pu J, Guo X, Bonifacino JS
Nat Cell Biol. 2015 Mar 23. doi: 10.1038/ncb3129.

Reviews

Buy FLJ20097 monoclonal antibody (M01), clone 2D11 now

Add to cart