Brand: | Abnova |
Reference: | H00055577-A01 |
Product name: | NAGK polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant NAGK. |
Gene id: | 55577 |
Gene name: | NAGK |
Gene alias: | GNK|HSA242910 |
Gene description: | N-acetylglucosamine kinase |
Genbank accession: | NM_017567 |
Immunogen: | NAGK (NP_060037, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLR |
Protein accession: | NP_060037 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NAGK polyclonal antibody (A01), Lot # 060102JC01. Western Blot analysis of NAGK expression in human ovarian cancer. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |