Brand: | Abnova |
Reference: | H00055576-A01 |
Product name: | STAB2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant STAB2. |
Gene id: | 55576 |
Gene name: | STAB2 |
Gene alias: | DKFZp434E0321|FEEL-2|FELE-2|FELL|FELL-2|FEX2|HARE|STAB-2 |
Gene description: | stabilin 2 |
Genbank accession: | NM_017564 |
Immunogen: | STAB2 (NP_060034, 367 a.a. ~ 465 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | ERLRELNTEPRGKWQGRLTSFISLLDKAYAWPLSKLGPFTVLLPTDKGLKGFNVNELLVDNKAAQYFVKLHIIAGQMNIEYMNNTDMFYTLTGKSGEIF |
Protein accession: | NP_060034 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |