Brand: | Abnova |
Reference: | H00055561-A01 |
Product name: | CDC42BPG polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant CDC42BPG. |
Gene id: | 55561 |
Gene name: | CDC42BPG |
Gene alias: | DMPK2|HSMDPKIN|KAPPA-200|MRCKgamma |
Gene description: | CDC42 binding protein kinase gamma (DMPK-like) |
Genbank accession: | NM_017525 |
Immunogen: | CDC42BPG (NP_059995, 1423 a.a. ~ 1528 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RREMLKDPFVRSKLISPPTNFNHLVHVGPANGRPGARDKSPAPEEKGRVARGSGPQRPHSFSEALRRPASMGSEGLGGDADPMKRKPWTSLSSESVSCPQGSLSPA |
Protein accession: | NP_059995 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |