RBM38 purified MaxPab mouse polyclonal antibody (B02P) View larger

RBM38 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RBM38 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about RBM38 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00055544-B02P
Product name: RBM38 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human RBM38 protein.
Gene id: 55544
Gene name: RBM38
Gene alias: HSRNASEB|RNPC1|SEB4B|SEB4D|dJ800J21.2
Gene description: RNA binding motif protein 38
Genbank accession: NM_017495
Immunogen: RBM38 (NP_059965.2, 1 a.a. ~ 239 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVIPAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ
Protein accession: NP_059965.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055544-B02P-13-15-1.jpg
Application image note: Western Blot analysis of RBM38 expression in transfected 293T cell line (H00055544-T02) by RBM38 MaxPab polyclonal antibody.

Lane 1: RNPC1 transfected lysate(26.29 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RBM38 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart