H2AFY2 purified MaxPab rabbit polyclonal antibody (D01P) View larger

H2AFY2 purified MaxPab rabbit polyclonal antibody (D01P)

H00055506-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of H2AFY2 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about H2AFY2 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00055506-D01P
Product name: H2AFY2 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human H2AFY2 protein.
Gene id: 55506
Gene name: H2AFY2
Gene alias: macroH2A2
Gene description: H2A histone family, member Y2
Genbank accession: NM_018649
Immunogen: H2AFY2 (NP_061119.1, 1 a.a. ~ 372 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDAK
Protein accession: NP_061119.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00055506-D01P-13-15-1.jpg
Application image note: Western Blot analysis of H2AFY2 expression in transfected 293T cell line (H00055506-T02) by H2AFY2 MaxPab polyclonal antibody.

Lane 1: H2AFY2 transfected lysate(40.10 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy H2AFY2 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart