TNFRSF19 monoclonal antibody (M02), clone 1H6 View larger

TNFRSF19 monoclonal antibody (M02), clone 1H6

H00055504-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TNFRSF19 monoclonal antibody (M02), clone 1H6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about TNFRSF19 monoclonal antibody (M02), clone 1H6

Brand: Abnova
Reference: H00055504-M02
Product name: TNFRSF19 monoclonal antibody (M02), clone 1H6
Product description: Mouse monoclonal antibody raised against a partial recombinant TNFRSF19.
Clone: 1H6
Isotype: IgG1 Kappa
Gene id: 55504
Gene name: TNFRSF19
Gene alias: TAJ|TAJ-alpha|TRADE|TROY
Gene description: tumor necrosis factor receptor superfamily, member 19
Genbank accession: NM_018647
Immunogen: TNFRSF19 (NP_061117, 30 a.a. ~ 119 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDAQCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLP
Protein accession: NP_061117
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055504-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055504-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged TNFRSF19 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TNFRSF19 monoclonal antibody (M02), clone 1H6 now

Add to cart