Brand: | Abnova |
Reference: | H00055366-M03 |
Product name: | LGR4 monoclonal antibody (M03), clone 8F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant LGR4. |
Clone: | 8F6 |
Isotype: | IgG2a Kappa |
Gene id: | 55366 |
Gene name: | LGR4 |
Gene alias: | GPR48 |
Gene description: | leucine-rich repeat-containing G protein-coupled receptor 4 |
Genbank accession: | NM_018490 |
Immunogen: | LGR4 (NP_060960.1, 852 a.a. ~ 950 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVK |
Protein accession: | NP_060960.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CNR2 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |