Brand: | Abnova |
Reference: | H00055361-M01 |
Product name: | PI4KII monoclonal antibody (M01), clone 3E1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PI4KII. |
Clone: | 3E1 |
Isotype: | IgG2b Kappa |
Gene id: | 55361 |
Gene name: | PI4K2A |
Gene alias: | DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6 |
Gene description: | phosphatidylinositol 4-kinase type 2 alpha |
Genbank accession: | NM_018425 |
Immunogen: | PI4KII (NP_060895.1, 383 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS |
Protein accession: | NP_060895.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PI4K2A is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |