Cart 42 Product Products 13 867,35 € (empty)
No products
To be determined Shipping
13 867,35 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 42 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 13 867,35 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 13 867,35 €
Data sheet of PI4KII purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about PI4KII purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00055361-B01P |
| Product name: | PI4KII purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PI4KII protein. |
| Gene id: | 55361 |
| Gene name: | PI4K2A |
| Gene alias: | DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6 |
| Gene description: | phosphatidylinositol 4-kinase type 2 alpha |
| Genbank accession: | NM_018425 |
| Immunogen: | PI4KII (NP_060895.1, 1 a.a. ~ 479 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQPLLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELAIERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFGRDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEKVPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVLDYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWRAYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW |
| Protein accession: | NP_060895 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PI4KII expression in transfected 293T cell line by PI4KII MaxPab polyclonal antibody. Lane 1: PI4KII transfected lysate(52.69 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |