VNN3 monoclonal antibody (M01), clone 3E1 View larger

VNN3 monoclonal antibody (M01), clone 3E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VNN3 monoclonal antibody (M01), clone 3E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about VNN3 monoclonal antibody (M01), clone 3E1

Brand: Abnova
Reference: H00055350-M01
Product name: VNN3 monoclonal antibody (M01), clone 3E1
Product description: Mouse monoclonal antibody raised against a partial recombinant VNN3.
Clone: 3E1
Isotype: IgG2b Kappa
Gene id: 55350
Gene name: VNN3
Gene alias: HSA238982|MGC171203|PAGEL-beta|PAGEL-eta|PAGEL-zeta
Gene description: vanin 3
Genbank accession: NM_018399
Immunogen: VNN3 (NP_060869.2, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
Protein accession: NP_060869.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055350-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055350-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged VNN3 is 3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VNN3 monoclonal antibody (M01), clone 3E1 now

Add to cart