VNN3 polyclonal antibody (A01) View larger

VNN3 polyclonal antibody (A01)

H00055350-A01_50uL

New product

286,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VNN3 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about VNN3 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055350-A01
Product name: VNN3 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant VNN3.
Gene id: 55350
Gene name: VNN3
Gene alias: HSA238982|MGC171203|PAGEL-beta|PAGEL-eta|PAGEL-zeta
Gene description: vanin 3
Genbank accession: NM_018399
Immunogen: VNN3 (NP_060869.2, 175 a.a. ~ 274 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
Protein accession: NP_060869.2
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055350-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055350-A01-1-22-1.jpg
Application image note: VNN3 polyclonal antibody (A01), Lot # 060703JCS1 Western Blot analysis of VNN3 expression in MES-SA/Dx5 ( Cat # L021V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VNN3 polyclonal antibody (A01) now

Add to cart