FBXL8 purified MaxPab rabbit polyclonal antibody (D01P) View larger

FBXL8 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXL8 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about FBXL8 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00055336-D01P
Product name: FBXL8 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human FBXL8 protein.
Gene id: 55336
Gene name: FBXL8
Gene alias: FBL8|FLJ11278|MGC19959
Gene description: F-box and leucine-rich repeat protein 8
Genbank accession: NM_018378.2
Immunogen: FBXL8 (NP_060848.2, 1 a.a. ~ 374 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA
Protein accession: NP_060848.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00055336-D01P-13-15-1.jpg
Application image note: Western Blot analysis of FBXL8 expression in transfected 293T cell line (H00055336-T01) by FBXL8 MaxPab polyclonal antibody.

Lane 1: FBXL8 transfected lysate(40.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FBXL8 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart