Brand: | Abnova |
Reference: | H00055336-D01 |
Product name: | FBXL8 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human FBXL8 protein. |
Gene id: | 55336 |
Gene name: | FBXL8 |
Gene alias: | FBL8|FLJ11278|MGC19959 |
Gene description: | F-box and leucine-rich repeat protein 8 |
Genbank accession: | NM_018378.2 |
Immunogen: | FBXL8 (NP_060848.2, 1 a.a. ~ 374 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAEPGEGLPEEVLALIFRHLSLRDRAAAARVCRAWAAAATCSAVWHDTKISCECELEGMLPPYLSACLDHIHNLRLEFEPSRKPSRRAAIELLMVLAGRAPGLRGLRLECRGEKPLFDAGRDVLEAVHAVCGAASQLRHLDLRRLSFTLDDALVLQAARSCPELHSLFLDNSTLVGSVGPGSVLELLEACPRLRALGLHLASLSHAILEALAAPDRAPFALLALRCACPEDARASPLPNEAWVALRRRHPGLAVELELEPALPAESVTRVLQPAVPVAALRLNLSGDTVGPVRFAAHHYAATLCALEVRAAASAELNAALEELAARCAALREVHCFCVVSHSVLDAFRAHCPRLRTYTLKLTREPHPWRPTLVA |
Protein accession: | NP_060848.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of FBXL8 transfected lysate using anti-FBXL8 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FBXL8 purified MaxPab mouse polyclonal antibody (B01P) (H00055336-B01P). |
Applications: | WB-Tr,IP |
Shipping condition: | Dry Ice |