TBC1D19 MaxPab mouse polyclonal antibody (B01) View larger

TBC1D19 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TBC1D19 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TBC1D19 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00055296-B01
Product name: TBC1D19 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human TBC1D19 protein.
Gene id: 55296
Gene name: TBC1D19
Gene alias: FLJ11082
Gene description: TBC1 domain family, member 19
Genbank accession: ENST00000264866
Immunogen: TBC1D19 (ENSP00000264866, 1 a.a. ~ 526 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLQEESDLSLIIAQIVQKLKGSNLYSQLERQAWASLQRPEIKLESLKEDIKEFFKISGWEKKLQNAVYSELSVFPLPSHPAAPPEHLKEPLVYMRKAQGSWEKRILKSLNSMCTELSIPLARKRPVGEQKELLNKWNEMGTDEPDLSLFRPVYAPKDFLEVLINLRNPNYENGDSLSFRTHLGLIQVPLKVKDIPELKECFVELGLNIGQLGIDDSTQVPPELFENEHVRIGQKVLAEQDSAAAQQYIRQGSPTALRAELWALILNISSQPEDVLYYEQLKTNVIQHDLLVDSLIYKDVKLTASNDDYYFVFEDYLYQVLLCFSRDTSVLSHFAFNSASPPKSYIRGKLGLEEYAVFYPPNGVIPFHGFSMYVAPLCFLYHEPSKLYQIFREMYVRFFFRLHSISSHPSGIVSLCLLFETLLQTYLPQLFYHLREIGAQPLRISFKWMVRAFSGYLATDQLLLLWDRILGYNSLEILAVLAAAVFAFRAVNLMEVTSLAAAEAVLADLSTLKVMPLLQIFLFATVT
Protein accession: ENSP00000264866
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055296-B01-13-15-1.jpg
Application image note: Western Blot analysis of TBC1D19 expression in transfected 293T cell line (H00055296-T01) by TBC1D19 MaxPab polyclonal antibody.

Lane 1: TBC1D19 transfected lysate(57.86 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TBC1D19 MaxPab mouse polyclonal antibody (B01) now

Add to cart