Brand: | Abnova |
Reference: | H00055294-M06 |
Product name: | FBXW7 monoclonal antibody (M06), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant FBXW7. |
Clone: | 1C11 |
Isotype: | IgG2a Kappa |
Gene id: | 55294 |
Gene name: | FBXW7 |
Gene alias: | AGO|CDC4|DKFZp686F23254|FBW6|FBW7|FBX30|FBXO30|FBXW6|FLJ16457|SEL-10|SEL10 |
Gene description: | F-box and WD repeat domain containing 7 |
Genbank accession: | NM_033632 |
Immunogen: | FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK |
Protein accession: | NP_361014 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00055294-M06-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00055294-M06-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |