FBXW7 polyclonal antibody (A01) View larger

FBXW7 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FBXW7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about FBXW7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055294-A01
Product name: FBXW7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FBXW7.
Gene id: 55294
Gene name: FBXW7
Gene alias: AGO|CDC4|DKFZp686F23254|FBW6|FBW7|FBX30|FBXO30|FBXW6|FLJ16457|SEL-10|SEL10
Gene description: F-box and WD repeat domain containing 7
Genbank accession: NM_033632
Immunogen: FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Protein accession: NP_361014
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055294-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.1 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055294-A01-1-6-1.jpg
Application image note: FBXW7 polyclonal antibody (A01), Lot # 051026JC01 Western Blot analysis of FBXW7 expression in Jurkat ( Cat # L017V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FBXW7 polyclonal antibody (A01) now

Add to cart