UEVLD purified MaxPab mouse polyclonal antibody (B01P) View larger

UEVLD purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UEVLD purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about UEVLD purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055293-B01P
Product name: UEVLD purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UEVLD protein.
Gene id: 55293
Gene name: UEVLD
Gene alias: ATTP|FLJ11068|UEV3
Gene description: UEV and lactate/malate dehyrogenase domains
Genbank accession: BC064566.1
Immunogen: UEVLD (AAH64566.1, 1 a.a. ~ 357 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEFDCEGLRRLLGKYKFRDLTVEELRNVNVFFPHFKYSMDTYGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSSSDEARQVDLLAYIAKITEGVSDTNSKSWANHENKTVNKITVVGGGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEISKDLSASAHSKVVIFTVNSLGSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIMTYVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQEEVVSHTSQVQLSNRDIMI
Protein accession: AAH64566.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055293-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UEVLD expression in transfected 293T cell line (H00055293-T01) by UEVLD MaxPab polyclonal antibody.

Lane 1: UEV3 transfected lysate(39.27 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UEVLD purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart