RHOT1 polyclonal antibody (A01) View larger

RHOT1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RHOT1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RHOT1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055288-A01
Product name: RHOT1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RHOT1.
Gene id: 55288
Gene name: RHOT1
Gene alias: ARHT1|FLJ11040|FLJ12633|MIRO-1
Gene description: ras homolog gene family, member T1
Genbank accession: NM_018307
Immunogen: RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Protein accession: NP_060777
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055288-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RHOT1 polyclonal antibody (A01) now

Add to cart