Cart 70 Product Products 29 706,00 € (empty)
No products
To be determined Shipping
29 706,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 70 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 29 706,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 29 706,00 €
Data sheet of C20orf20 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,WB-Tr |
More info about C20orf20 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00055257-B01P |
| Product name: | C20orf20 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human C20orf20 protein. |
| Gene id: | 55257 |
| Gene name: | C20orf20 |
| Gene alias: | Eaf7|FLJ10914|MRG15BP|MRGBP|URCC4 |
| Gene description: | chromosome 20 open reading frame 20 |
| Genbank accession: | NM_018270.3 |
| Immunogen: | C20orf20 (NP_060740.1, 1 a.a. ~ 204 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICIRDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRSRVTDKVLTANSNPSSPSAAKRRRT |
| Protein accession: | NP_060740.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of C20orf20 expression in transfected 293T cell line (H00055257-T01) by C20orf20 MaxPab polyclonal antibody. Lane 1: C20orf20 transfected lysate(22.44 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,IF,WB-Tr |
| Shipping condition: | Dry Ice |