ADI1 purified MaxPab mouse polyclonal antibody (B01P) View larger

ADI1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ADI1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ADI1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055256-B01P
Product name: ADI1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ADI1 protein.
Gene id: 55256
Gene name: ADI1
Gene alias: APL1|ARD|FLJ10913|HMFT1638|MTCBP-1|MTCBP1|SIP-L|SIPL
Gene description: acireductone dioxygenase 1
Genbank accession: NM_018269.1
Immunogen: ADI1 (NP_060739.1, 1 a.a. ~ 179 a.a) full-length human protein.
Immunogen sequence/protein sequence: MVLAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERNYSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFMEKGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA
Protein accession: NP_060739.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055256-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ADI1 expression in transfected 293T cell line (H00055256-T02) by ADI1 MaxPab polyclonal antibody.

Lane 1: MTCBP-1 transfected lysate(19.69 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ADI1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart