PCMTD2 purified MaxPab mouse polyclonal antibody (B01P) View larger

PCMTD2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCMTD2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PCMTD2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055251-B01P
Product name: PCMTD2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PCMTD2 protein.
Gene id: 55251
Gene name: PCMTD2
Gene alias: C20orf36|FLJ10883|KIAA0835|KIAA1050
Gene description: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2
Genbank accession: BC033665
Immunogen: PCMTD2 (AAH33665, 1 a.a. ~ 361 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGGAVSAGEDNDELIDNLKEAQYIRTELVEQAFRAIDRADYYLEEFKENAYKDLAWKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVIEYAKQKLDFFIRTSDSFDKFDFCEPSFVTGNCLEISPDCSQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLIQPCHSESGKSRLVQLPPVAVRSLQDLARIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK
Protein accession: AAH33665
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055251-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PCMTD2 expression in transfected 293T cell line by PCMTD2 MaxPab polyclonal antibody.

Lane 1: PCMTD2 transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PCMTD2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart