FLJ10808 monoclonal antibody (M08), clone 1D11 View larger

FLJ10808 monoclonal antibody (M08), clone 1D11

H00055236-M08_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ10808 monoclonal antibody (M08), clone 1D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re

More info about FLJ10808 monoclonal antibody (M08), clone 1D11

Brand: Abnova
Reference: H00055236-M08
Product name: FLJ10808 monoclonal antibody (M08), clone 1D11
Product description: Mouse monoclonal antibody raised against a partial recombinant FLJ10808.
Clone: 1D11
Isotype: IgG2b Kappa
Gene id: 55236
Gene name: UBA6
Gene alias: FLJ10808|FLJ23367|MOP-4|UBE1L2
Gene description: ubiquitin-like modifier activating enzyme 6
Genbank accession: NM_018227
Immunogen: FLJ10808 (NP_060697, 962 a.a. ~ 1051 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHDT
Protein accession: NP_060697
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055236-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.64 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055236-M08-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to UBA6 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLJ10808 monoclonal antibody (M08), clone 1D11 now

Add to cart