PANK4 monoclonal antibody (M10), clone 3C1 View larger

PANK4 monoclonal antibody (M10), clone 3C1

H00055229-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PANK4 monoclonal antibody (M10), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about PANK4 monoclonal antibody (M10), clone 3C1

Brand: Abnova
Reference: H00055229-M10
Product name: PANK4 monoclonal antibody (M10), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant PANK4.
Clone: 3C1
Isotype: IgG2a Kappa
Gene id: 55229
Gene name: PANK4
Gene alias: DKFZp547M242|FLJ10782
Gene description: pantothenate kinase 4
Genbank accession: NM_018216
Immunogen: PANK4 (NP_060686.1, 673 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AGMDPVVHSALQEERLLLVQTGSSSPCLDLSRLDKGLAALVRERGADLVVIEGMGRAVHTNYHAALRCESLKLAVIKNAWLAERLGGRLFSVIFKYEVPAE
Protein accession: NP_060686.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055229-M10-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged PANK4 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy PANK4 monoclonal antibody (M10), clone 3C1 now

Add to cart