FLJ10774 polyclonal antibody (A01) View larger

FLJ10774 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ10774 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about FLJ10774 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055226-A01
Product name: FLJ10774 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant FLJ10774.
Gene id: 55226
Gene name: NAT10
Gene alias: ALP|DKFZp434C116|FLJ10774|FLJ12179|FLJ23850|KIAA1709|hALP
Gene description: N-acetyltransferase 10 (GCN5-related)
Genbank accession: NM_024662
Immunogen: FLJ10774 (NP_078938, 2 a.a. ~ 98 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: HRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYKKELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIA
Protein accession: NP_078938
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055226-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLJ10774 polyclonal antibody (A01) now

Add to cart