FANCI MaxPab mouse polyclonal antibody (B01) View larger

FANCI MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FANCI MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about FANCI MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00055215-B03
Product name: FANCI MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human FANCI protein.
Gene id: 55215
Gene name: FANCI
Gene alias: FLJ10719|KIAA1794
Gene description: Fanconi anemia, complementation group I
Genbank accession: BC004277
Immunogen: FANCI (AAH04277, 1 a.a. ~ 73 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSALDKQHNEEQSGDE
Protein accession: AAH04277
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055215-B03-13-15-1.jpg
Application image note: Western Blot analysis of FANCI expression in transfected 293T cell line (H00055215-T04) by FANCI MaxPab polyclonal antibody.

Lane 1: FANCI transfected lysate(8.14 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FANCI MaxPab mouse polyclonal antibody (B01) now

Add to cart