RPRD1A monoclonal antibody (M02), clone 1B9 View larger

RPRD1A monoclonal antibody (M02), clone 1B9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RPRD1A monoclonal antibody (M02), clone 1B9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about RPRD1A monoclonal antibody (M02), clone 1B9

Brand: Abnova
Reference: H00055197-M02
Product name: RPRD1A monoclonal antibody (M02), clone 1B9
Product description: Mouse monoclonal antibody raised against a partial recombinant RPRD1A.
Clone: 1B9
Isotype: IgG2b Kappa
Gene id: 55197
Gene name: RPRD1A
Gene alias: FLJ10656|HsT3101|MGC19513|P15RS
Gene description: regulation of nuclear pre-mRNA domain containing 1A
Genbank accession: NM_018170
Immunogen: RPRD1A (NP_060640, 76 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EFTKDFAPVIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTLDLVRAL
Protein accession: NP_060640
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055197-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055197-M02-1-4-1.jpg
Application image note: RPRD1A monoclonal antibody (M02), clone 1B9. Western Blot analysis of RPRD1A expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RPRD1A monoclonal antibody (M02), clone 1B9 now

Add to cart