Brand: | Abnova |
Reference: | H00055191-M01 |
Product name: | NADSYN1 monoclonal antibody (M01), clone 4G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NADSYN1. |
Clone: | 4G9 |
Isotype: | IgG1 Kappa |
Gene id: | 55191 |
Gene name: | NADSYN1 |
Gene alias: | FLJ10631|FLJ36703|FLJ40627 |
Gene description: | NAD synthetase 1 |
Genbank accession: | NM_018161 |
Immunogen: | NADSYN1 (NP_004981, 609 a.a. ~ 706 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAENYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD |
Protein accession: | NP_004981 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NADSYN1 monoclonal antibody (M01), clone 4G9 Western Blot analysis of NADSYN1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |