Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00055186-B02 |
Product name: | SLC25A36 MaxPab mouse polyclonal antibody (B02) |
Product description: | Mouse polyclonal antibody raised against a full-length human SLC25A36 protein. |
Gene id: | 55186 |
Gene name: | SLC25A36 |
Gene alias: | DKFZp564C053|FLJ10618 |
Gene description: | solute carrier family 25, member 36 |
Genbank accession: | BC014064 |
Immunogen: | SLC25A36 (AAH14064, 1 a.a. ~ 311 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSQRDTLVHLFAGGCGGTVGAILTCPLEVVKTRLQSSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLGPNLVGVAPSRAIYFAAYSNCKEKLNDVFDPDSTQVHMISAAMAGFTAITATNPIWLIKTRLQLDARNRGERRMGAFECVRKVYQTDGLKGFYRGMSASYAGISETVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEVVRTRLREEGTKYRSFFQTLSLLVQEEGYGSLYRGLTTHLVRQIPNTAIMMATYELVVYLLNG |
Protein accession: | AAH14064 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of SLC25A36 expression in transfected 293T cell line (H00055186-T02) by SLC25A36 MaxPab polyclonal antibody. Lane 1: SLC25A36 transfected lysate(34.21 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |