MRPS10 MaxPab mouse polyclonal antibody (B02) View larger

MRPS10 MaxPab mouse polyclonal antibody (B02)

H00055173-B02_50uL

New product

395,00 € tax excl.

50 uL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MRPS10 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MRPS10 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00055173-B02
Product name: MRPS10 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human MRPS10 protein.
Gene id: 55173
Gene name: MRPS10
Gene alias: FLJ10567|MRP-S10|PNAS-122
Gene description: mitochondrial ribosomal protein S10
Genbank accession: NM_018141
Immunogen: MRPS10 (NP_060611, 1 a.a. ~ 201 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAARTAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDEPDILYKRLSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLQSVHIYKKHRVQYEMRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEVTKTQLEQLPEHIKEPIWETLSEEKEESKS
Protein accession: NP_060611
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055173-B02-13-15-1.jpg
Application image note: Western Blot analysis of MRPS10 expression in transfected 293T cell line (H00055173-T02) by MRPS10 MaxPab polyclonal antibody.

Lane 1: MRPS10 transfected lysate(22.11 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MRPS10 MaxPab mouse polyclonal antibody (B02) now

Add to cart