RNF184 polyclonal antibody (A01) View larger

RNF184 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF184 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about RNF184 polyclonal antibody (A01)

Brand: Abnova
Reference: H00055167-A01
Product name: RNF184 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant RNF184.
Gene id: 55167
Gene name: MSL2
Gene alias: FLJ10546|KIAA1585|MSL-2|MSL2L1|RNF184
Gene description: male-specific lethal 2 homolog (Drosophila)
Genbank accession: NM_018133
Immunogen: RNF184 (NP_060603, 478 a.a. ~ 575 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: GQRCPCYSNRKACLDCICRGCQNSYMANGEKKLEAFAVPEKALEQTRLTLGINVTSIAVRNASTSTSVINVTGSPVTTFLAASTHDDKSLDEAIDMRF
Protein accession: NP_060603
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00055167-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RNF184 polyclonal antibody (A01) now

Add to cart