MSTO1 purified MaxPab mouse polyclonal antibody (B01P) View larger

MSTO1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSTO1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MSTO1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00055154-B01P
Product name: MSTO1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MSTO1 protein.
Gene id: 55154
Gene name: MSTO1
Gene alias: DKFZp686B1757|DKFZp686I01261|FLJ10504|LST005|MST|RP11-29H23.3
Gene description: misato homolog 1 (Drosophila)
Genbank accession: NM_018116
Immunogen: MSTO1 (NP_060586, 1 a.a. ~ 570 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRATDSKEPPGELCPDVLYRTGRTLHGQETYTPRLILMDLKGSLSSLKEEGGLYRDKQLDAAIAWQGKLTTHKEELYPKNPYLQDFLSAEGVLSSDGVWRVKSIPNGKGSSPLPTATTPKPLIPTEASIRVWSDFLRVHLHPRSICMIQKYNHDGEAGRLEAFGQGESVLKEPKYQEELEDRLHFYVEECDYLQGFQILCDLHDGFSGVGAKAAELLQDEYSGRGIITWGLLPGPYHRGEAQRNIYRLLNTAFGLVHLTAHSSLVCPLSLGGSLGLRPEPPVSFPYLHYDATLPFHCSAILATALDTVTVPYRLCSSPVSMVHLADMLSFCGKKVVTAGAIIPFPLAPGQSLPDSLMQFGGATPWTPLSACGEPSGTRCFAQSVVLRGIDRACHTSQLTPGTPPPSALHACTTGEEILAQYLQQQQPGVMSSSHLLLTPCRVAPPYPHLFSSCSPPGMVLDGSPKGAAVESIPVFGALCSSSSLHQTLEALARDLTKLDLRRWASFMDAGVEHDDVAELLQELQSLAQCYQGGDSLVD
Protein accession: NP_060586
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00055154-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MSTO1 expression in transfected 293T cell line by MSTO1 MaxPab polyclonal antibody.

Lane 1: MSTO1 transfected lysate(62.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MSTO1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart