Brand: | Abnova |
Reference: | H00055145-D01 |
Product name: | THAP1 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human THAP1 protein. |
Gene id: | 55145 |
Gene name: | THAP1 |
Gene alias: | FLJ10477|MGC33014 |
Gene description: | THAP domain containing, apoptosis associated protein 1 |
Genbank accession: | NM_018105.2 |
Immunogen: | THAP1 (NP_060575.1, 1 a.a. ~ 213 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLMPPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA |
Protein accession: | NP_060575.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | THAP1 MaxPab rabbit polyclonal antibody. Western Blot analysis of THAP1 expression in Jurkat. |
Applications: | WB-Ce,WB-Tr,IP |
Shipping condition: | Dry Ice |