Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of FANCL purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Ti,IF,WB-Tr |
More info about FANCL purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00055120-D01P |
| Product name: | FANCL purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human FANCL protein. |
| Gene id: | 55120 |
| Gene name: | FANCL |
| Gene alias: | FAAP43|FLJ10335|PHF9|POG |
| Gene description: | Fanconi anemia, complementation group L |
| Genbank accession: | NM_018062.2 |
| Immunogen: | FANCL (NP_060532.2, 1 a.a. ~ 375 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH |
| Protein accession: | NP_060532.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of FANCL expression in transfected 293T cell line (H00055120-T02) by FANCL MaxPab polyclonal antibody. Lane 1: FANCL transfected lysate(42.90 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Ti,IF,WB-Tr |
| Shipping condition: | Dry Ice |