Cart 6 Product Products 956,19 € (empty)
-
1 x Amphiregul...259,07 € -
-
-
-
-
No products
To be determined Shipping
956,19 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 956,19 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 956,19 €
Data sheet of TXNL4B purified MaxPab mouse polyclonal antibody (B02P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,WB-Tr |
More info about TXNL4B purified MaxPab mouse polyclonal antibody (B02P)
| Brand: | Abnova |
| Reference: | H00054957-B02P |
| Product name: | TXNL4B purified MaxPab mouse polyclonal antibody (B02P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human TXNL4B protein. |
| Gene id: | 54957 |
| Gene name: | TXNL4B |
| Gene alias: | DLP|Dim2|FLJ20511 |
| Gene description: | thioredoxin-like 4B |
| Genbank accession: | NM_017853 |
| Immunogen: | TXNL4B (NP_060323.1, 1 a.a. ~ 149 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI |
| Protein accession: | NP_060323.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of TXNL4B expression in transfected 293T cell line (H00054957-T02) by TXNL4B MaxPab polyclonal antibody. Lane 1: TXNL4B transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |