FLJ20464 (Human) Recombinant Protein (P01) View larger

FLJ20464 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FLJ20464 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about FLJ20464 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00054944-P01
Product name: FLJ20464 (Human) Recombinant Protein (P01)
Product description: Human FLJ20464 full-length ORF ( CAK54489.1, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 54944
Gene name: FLJ20464
Gene alias: -
Gene description: hypothetical protein FLJ20464
Genbank accession: CU013058
Immunogen sequence/protein sequence: MREIPRSRLRPPPCFKHQRGPGVLAGDRPNLRSCFCTRYIDRSDGLRARKSWRDEASVQLLPQTTARRALSPGSVKSPAPGGDNMRAMDGAGTPGSPSNPQGSGGAGGVGDTLRPLQARSIPSARSPVRRRVLW
Protein accession: CAK54489.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00054944-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FLJ20464 (Human) Recombinant Protein (P01) now

Add to cart