Cart 6 Product Products 956,19 € (empty)
-
1 x Amphiregul...259,07 € -
-
-
-
-
No products
To be determined Shipping
956,19 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 6 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 956,19 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 956,19 €
Data sheet of OCIAD1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,WB-Tr |
More info about OCIAD1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00054940-B01P |
| Product name: | OCIAD1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human OCIAD1 protein. |
| Gene id: | 54940 |
| Gene name: | OCIAD1 |
| Gene alias: | Asrij|FLJ20455|MGC111072|OCIA|TPA018 |
| Gene description: | OCIA domain containing 1 |
| Genbank accession: | BC003409 |
| Immunogen: | OCIAD1 (AAH03409, 1 a.a. ~ 245 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSHPKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSGQSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE |
| Protein accession: | AAH03409 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | OCIAD1 MaxPab polyclonal antibody. Western Blot analysis of OCIAD1 expression in human pancreas. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The influence of neural cell adhesion molecule isoform 140 on the metastasis of thyroid carcinoma.Yang AH, Chau YP, Lee CH, Chen JY, Chen JY, Ke CC, Liu RS. Clin Exp Metastasis. 2012 Sep 27. [Epub ahead of print] |