Brand: | Abnova |
Reference: | H00054937-D01 |
Product name: | SOHLH2 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human SOHLH2 protein. |
Gene id: | 54937 |
Gene name: | SOHLH2 |
Gene alias: | FLJ20449|TEB1|bA121N13.2 |
Gene description: | spermatogenesis and oogenesis specific basic helix-loop-helix 2 |
Genbank accession: | BC025383.2 |
Immunogen: | SOHLH2 (AAH25383.1, 1 a.a. ~ 225 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW |
Protein accession: | AAH25383.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SOHLH2 MaxPab rabbit polyclonal antibody. Western Blot analysis of SOHLH2 expression in human liver. |
Applications: | WB-Ti,WB-Tr,IP |
Shipping condition: | Dry Ice |