TEB1 purified MaxPab mouse polyclonal antibody (B01P) View larger

TEB1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TEB1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about TEB1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00054937-B01P
Product name: TEB1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TEB1 protein.
Gene id: 54937
Gene name: SOHLH2
Gene alias: FLJ20449|TEB1|bA121N13.2
Gene description: spermatogenesis and oogenesis specific basic helix-loop-helix 2
Genbank accession: BC025383.2
Immunogen: TEB1 (AAH25383.1, 1 a.a. ~ 225 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASSIICQEHCQISGQAKIDILLVGDVTVGYLADTVQKLFANIAEVTITISDTKEAAALLDDCIFNMVLLKVPSSLSAEELEAIKLIRFGKKKNTHSLFVFIIPENFKGCISGHGMDIALTEPLTMEKMSNVVKYWTTCPSNTVKTENATGPEELGLPLQRSYSEHLGYFPTDLFACSESLRNGNGLELNASLSEFEKNKKISLLHSSKEKLRRLYRKHSSFCFW
Protein accession: AAH25383.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054937-B01P-13-15-1.jpg
Application image note: Western Blot analysis of SOHLH2 expression in transfected 293T cell line (H00054937-T01) by SOHLH2 MaxPab polyclonal antibody.

Lane 1: TEB1 transfected lysate(24.75 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TEB1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart