Cart 196 Product Products 68 762,10 € (empty)
No products
To be determined Shipping
68 762,10 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 196 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 68 762,10 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 68 762,10 €
Data sheet of DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IF,WB-Tr |
More info about DUSP23 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00054935-D01P |
| Product name: | DUSP23 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human DUSP23 protein. |
| Gene id: | 54935 |
| Gene name: | DUSP23 |
| Gene alias: | DUSP25|FLJ20442|LDP-3|MOSP|RP11-190A12.1|VHZ |
| Gene description: | dual specificity phosphatase 23 |
| Genbank accession: | NM_017823.3 |
| Immunogen: | DUSP23 (NP_060293.2, 1 a.a. ~ 150 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPAPDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEKAVFQFYQRTK |
| Protein accession: | NP_060293.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DUSP23 expression in transfected 293T cell line (H00054935-T02) by DUSP23 MaxPab polyclonal antibody. Lane 1: DUSP23 transfected lysate(16.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,WB-Tr |
| Shipping condition: | Dry Ice |