CMTM6 (Human) Recombinant Protein (Q01) View larger

CMTM6 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CMTM6 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about CMTM6 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00054918-Q01
Product name: CMTM6 (Human) Recombinant Protein (Q01)
Product description: Human CMTM6 partial ORF (NP_060271.1, 1 a.a. - 85 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 54918
Gene name: CMTM6
Gene alias: CKLFSF6|FLJ20396|PRO2219
Gene description: CKLF-like MARVEL transmembrane domain containing 6
Genbank accession: NM_017801.2
Immunogen sequence/protein sequence: MENGAVYSPTTEEDPGPARGPRSGLAAYFFMGRLPLLRRVLKGLQLLLSLLAFICEEVVSQCTLCGGLYFFEFVSCSAFLLSLLI
Protein accession: NP_060271.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00054918-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CMTM6 (Human) Recombinant Protein (Q01) now

Add to cart