Brand: | Abnova |
Reference: | H00054875-A01 |
Product name: | C9orf39 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant C9orf39. |
Gene id: | 54875 |
Gene name: | CNTLN |
Gene alias: | C9orf101|C9orf39|FLJ20276|FLJ25636|RP11-340N12.1|bA340N12.1 |
Gene description: | centlein, centrosomal protein |
Genbank accession: | NM_017738 |
Immunogen: | C9orf39 (NP_060208, 971 a.a. ~ 1070 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QNDVHVVRRQIRELKKMKKNRDACKTSTHKAQTLAASILNISRSDLEEILDTEDQVEIEKTKIDAENDKEWMLYIQKLLEGQSLALSPRLKCNGAIMAHQ |
Protein accession: | NP_060208 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |