Brand: | Abnova |
Reference: | H00054825-A01 |
Product name: | PC-LKC polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PC-LKC. |
Gene id: | 54825 |
Gene name: | PCDH24 |
Gene alias: | FLJ20124|FLJ20383|MGC163154|PC-LKC|PCLKC |
Gene description: | protocadherin 24 |
Genbank accession: | NM_017675 |
Immunogen: | PC-LKC (NP_060145, 210 a.a. ~ 318 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GGMYHNTFTIQCSLPVFLSISVVDQPDLDPQFVREFYSASVAEDAAKGTSVLTVEAVDGDKGINDPVIYSISYSTRPGWFDIGADGVIRVNGSLDREQLLEADEEVQLQ |
Protein accession: | NP_060145 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Galectin-1 and Galectin-3 Mediate Protocadherin-24-Dependent Membrane Localization of β-catenin in Colon Cancer Cell Line HCT116.Ose R, Ohara O, Nagase T. Current Chemical Genomics, 2012, 6, (Suppl 1-M3) 18-26 |