Cart 192 Product Products 67 698,54 € (empty)
No products
To be determined Shipping
67 698,54 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 192 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 67 698,54 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 67 698,54 €
Data sheet of ZNF280D purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about ZNF280D purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00054816-B01P |
| Product name: | ZNF280D purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ZNF280D protein. |
| Gene id: | 54816 |
| Gene name: | ZNF280D |
| Gene alias: | MGC21637|MGC61687|SUHW4|ZNF634 |
| Gene description: | zinc finger protein 280D |
| Genbank accession: | NM_001002844 |
| Immunogen: | ZNF280D (NP_001002844.1, 1 a.a. ~ 158 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGDNPFQPKSNSKMAELFMECEEEELEPWQKKVKEVEDDDDDEPIFVGEISSSKPAISNILNRVNPSSYSRGLKNGALSRGITAAFKPTSQHYTNPTSNPVPASPINFHPESRSSDSSVIVQPFSKPVSVSKTIRPAQGSIGCCLSISTVPSYNSGLS |
| Protein accession: | NP_001002844.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of ZNF280D expression in transfected 293T cell line (H00054816-T01) by ZNF280D MaxPab polyclonal antibody. Lane 1: SUHW4 transfected lysate(17.38 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |