Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNF111 monoclonal antibody (M05), clone 1C4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about RNF111 monoclonal antibody (M05), clone 1C4
| Brand: | Abnova |
| Reference: | H00054778-M05 |
| Product name: | RNF111 monoclonal antibody (M05), clone 1C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RNF111. |
| Clone: | 1C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 54778 |
| Gene name: | RNF111 |
| Gene alias: | ARK|DKFZp313E0731|DKFZp686H1966|DKFZp761D081|FLJ38008 |
| Gene description: | ring finger protein 111 |
| Genbank accession: | NM_017610 |
| Immunogen: | RNF111 (NP_060080, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSQWTPEYNELYTLKVDMKSEIPSDAPKTQESLKGILLHPEPIGAAKSFPAGVEMINSKVGNEFSHLCDDSQKQEKEMNGNQQEQEKSLVVRKKRKSQQAGPSYVQNC |
| Protein accession: | NP_060080 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.62 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of RNF111 over-expressed 293 cell line, cotransfected with RNF111 Validated Chimera RNAi ( Cat # H00054778-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with RNF111 monoclonal antibody (M05), clone 1C4 (Cat # H00054778-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | SUMO and ubiquitin-dependent XPC exchange drives nucleotide excision repair.van Cuijk L, van Belle GJ, Turkyilmaz Y, Poulsen SL, Janssens RC, Theil AF, Sabatella M, Lans H, Mailand N, Houtsmuller AB, Vermeulen W, Marteijn JA1. Nat Commun. 2015 Jul 7;6:7499. |