DIRAS2 purified MaxPab mouse polyclonal antibody (B01P) View larger

DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00054769-B01P
Product name: DIRAS2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human DIRAS2 protein.
Gene id: 54769
Gene name: DIRAS2
Gene alias: DKFZp761C07121|Di-Ras2
Gene description: DIRAS family, GTP-binding RAS-like 2
Genbank accession: NM_017594
Immunogen: DIRAS2 (NP_060064.2, 1 a.a. ~ 199 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPEQSNDYRVAVFGAGGVGKSSLVLRFVKGTFRESYIPTVEDTYRQVISCDKSICTLQITDTTGSHQFPAMQRLSISKGHAFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDGKKSKQQKRKEKLKGKCVIM
Protein accession: NP_060064.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054769-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DIRAS2 expression in transfected 293T cell line (H00054769-T01) by DIRAS2 MaxPab polyclonal antibody.

Lane 1: DIRAS2 transfected lysate(21.89 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DIRAS2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart