DIRAS2 polyclonal antibody (A01) View larger

DIRAS2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DIRAS2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about DIRAS2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00054769-A01
Product name: DIRAS2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DIRAS2.
Gene id: 54769
Gene name: DIRAS2
Gene alias: DKFZp761C07121|Di-Ras2
Gene description: DIRAS family, GTP-binding RAS-like 2
Genbank accession: NM_017594
Immunogen: DIRAS2 (NP_060064, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AFILVYSITSRQSLEELKPIYEQICEIKGDVESIPIMLVGNKCDESPSREVQSSEAEALARTWKCAFMETSAKLNHNVKELFQELLNLEKRRTVSLQIDG
Protein accession: NP_060064
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00054769-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00054769-A01-13-15-1.jpg
Application image note: Western Blot analysis of DIRAS2 expression in transfected 293T cell line by DIRAS2 polyclonal antibody (A01).

Lane1:DIRAS2 transfected lysate (Predicted MW: 22.5 KDa).
Lane2:Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DIRAS2 polyclonal antibody (A01) now

Add to cart